CacheBy
Atlas Antibodies Anti-PLA2G4A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PLA2G4A Antibody

상품 한눈에 보기

인간 PLA2G4A 단백질을 표적으로 하는 토끼 폴리클로날 항체. IHC 및 ICC 실험에 적합하며, PrEST 항원으로 친화 정제됨. 높은 종간 서열 동일성(쥐 89%, 생쥐 88%)을 보유. 안정화용 글리세롤 및 PBS 버퍼 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA054206-100 Anti-PLA2G4A Antibody, phospholipase A2, group IVA (cytosolic, calcium-dependent) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054206-25 Anti-PLA2G4A Antibody, phospholipase A2, group IVA (cytosolic, calcium-dependent) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PLA2G4A Antibody

Anti-PLA2G4A Antibody

Target: phospholipase A2, group IVA (cytosolic, calcium-dependent)

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human PLA2G4A.

Alternative Gene Names

  • cPLA2-alpha
  • PLA2G4

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein phospholipase A2, group IVA (cytosolic, calcium-dependent)
Target Gene PLA2G4A
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat (89%), Mouse (88%)

Antigen Sequence

TVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSGSQSRGSTMEEELENITTKHIVSNDSSDSDDESHEPKGTENEDAGSDYQ

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.