원본
Thermo Fisher Scientific HuD Polyclonal Antibody
상품 한눈에 보기
HuD 단백질(ELAVL4)을 인식하는 Rabbit Polyclonal 항체로, Human, Mouse, Rat에 반응합니다. WB 및 IHC(P) 등에 사용 가능하며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며 재구성 후 500 µg/mL 농도로 사용 가능합니다.
- 카탈로그번호
- PA579199
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오후 12:55
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA579199 HuD Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific HuD Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | - |
| Immunohistochemistry (IHC) | – | 2 publications |
| Immunohistochemistry (Paraffin) (IHC-P) | 0.5–1 µg/mL | 1 publication |
| Immunohistochemistry (Frozen) (IHC-F) | – | 1 publication |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Published Species | Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human ELAVL4 (8–45 aa, MEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | –20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746315 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
HuD (ELAVL4, PNEM)는 인간 ELAVL4 유전자(염색체 1p34)에 의해 발현되는 RNA 결합 단백질입니다.
이 단백질은 성장 인자 mRNA의 3' UTR의 uridylate-rich 영역에 특이적으로 결합하여 mRNA의 반감기를 증가시킵니다.
HuD는 신경세포에서만 발현되며, 뇌 발달과 신경 가소성에 중요한 역할을 합니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific EME1 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific EPB41L1 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific eIF6 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific Neutrophil elastase Polyclonal Antibody568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.