Thermo Fisher Scientific HuD Polyclonal Antibody
HuD 단백질(ELAVL4)을 인식하는 Rabbit Polyclonal 항체로, Human, Mouse, Rat에 반응합니다. WB 및 IHC(P) 등에 사용 가능하며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며 재구성 후 500 µg/mL 농도로 사용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | - |
| Immunohistochemistry (IHC) | – | 2 publications |
| Immunohistochemistry (Paraffin) (IHC-P) | 0.5–1 µg/mL | 1 publication |
| Immunohistochemistry (Frozen) (IHC-F) | – | 1 publication |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Published Species | Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human ELAVL4 (8–45 aa, MEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | –20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746315 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
HuD (ELAVL4, PNEM)는 인간 ELAVL4 유전자(염색체 1p34)에 의해 발현되는 RNA 결합 단백질입니다.
이 단백질은 성장 인자 mRNA의 3' UTR의 uridylate-rich 영역에 특이적으로 결합하여 mRNA의 반감기를 증가시킵니다.
HuD는 신경세포에서만 발현되며, 뇌 발달과 신경 가소성에 중요한 역할을 합니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific EME1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific EPB41L1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific HuD Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific eIF6 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Neutrophil elastase Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|