CacheBy
Thermo Fisher Scientific EME1 Polyclonal Antibody
원본

Thermo Fisher Scientific EME1 Polyclonal Antibody

상품 한눈에 보기

EME1 단백질을 인식하는 Rabbit Polyclonal 항체로, WB, IHC, ICC, Flow Cytometry 등 다양한 응용에 적합. Human 및 Rat에 반응하며, 항원 친화 크로마토그래피로 정제됨. 동결 건조 상태로 제공되며, 재구성 시 500 µg/mL 농도 유지.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 01. 오후 11:38
Thermo Fisher Scientific PA579202 EME1 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific EME1 Polyclonal Antibody

Applications and Tested Dilutions

Application Tested Dilution
Western Blot (WB) 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC-P) 0.5–1 µg/mL
Immunohistochemistry (Frozen) (IHC-F) 0.5–1 µg/mL
Immunocytochemistry (ICC/IF) 0.5–1 µg/mL
Flow Cytometry (Flow) 1–3 µg/1×10⁶ cells

Product Specifications

Specification Description
Species Reactivity Human, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen Synthetic peptide corresponding to a sequence at the C-terminus of human EME1 (520–561 aa: DKERQNLLADIQVRRGEGVTSTSRRIGPELSRRIYLQMTTLQ)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 5 mg BSA
Contains 0.05 mg sodium azide
Storage Conditions –20°C
Shipping Conditions Ambient (domestic); Wet ice (international)
RRID AB_2746318

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

EME1 and MUS81 form an endonuclease complex that cleaves branched DNA structures, particularly those arising during stalled DNA replication (Abraham et al., 2003).


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.