Thermo Fisher Scientific EME1 Polyclonal Antibody
상품 한눈에 보기
EME1 단백질을 인식하는 Rabbit Polyclonal 항체로, WB, IHC, ICC, Flow Cytometry 등 다양한 응용에 적합. Human 및 Rat에 반응하며, 항원 친화 크로마토그래피로 정제됨. 동결 건조 상태로 제공되며, 재구성 시 500 µg/mL 농도 유지.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC-P) | 0.5–1 µg/mL |
| Immunohistochemistry (Frozen) (IHC-F) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 0.5–1 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminus of human EME1 (520–561 aa: DKERQNLLADIQVRRGEGVTSTSRRIGPELSRRIYLQMTTLQ) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | –20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746318 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
EME1 and MUS81 form an endonuclease complex that cleaves branched DNA structures, particularly those arising during stalled DNA replication (Abraham et al., 2003).
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific HIF-2 alpha Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific CD105 (Endoglin) Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific EME1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific EPB41L1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific HuD Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.