
Thermo Fisher Scientific ICA1 Polyclonal Antibody
ICA1 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody입니다. Western blot에 적합하며 Human, Mouse, Rat 시료에 반응합니다. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공됩니다. 연구용으로만 사용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
- Western Blot (WB): 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human ICA1 (243–276aa EKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746542 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene encodes a protein with an arfaptin homology domain found both in the cytosol and as a membrane-bound form on the Golgi complex and immature secretory granules.
It is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjögren’s syndrome.
Alternatively spliced variants encoding different isoforms have been described, though not all have been fully characterized.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific ICAM-1 (CD54) Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific ICAM-1 (CD54) Polyclonal Antibody
668,200원

Thermo Fisher Scientific
Thermo Fisher Scientific ICA1 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific Bone SialoProtein Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific Bone SialoProtein Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|