
Atlas Antibodies Anti-PINK1 Antibody
상품 한눈에 보기
사람 PINK1 단백질에 특이적인 폴리클로날 항체로, 면역조직화학 등 다양한 연구용 응용에 적합합니다. Rabbit 유래 IgG로 제작되었으며, PrEST 항원으로 친화 정제되었습니다. Human에 반응하며 Rat, Mouse와도 높은 상동성을 보입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PINK1 Antibody
PTEN Induced Putative Kinase 1
Recommended Applications
면역조직화학(IHC) 등 다양한 연구용 응용에 적합
(이미지 내 텍스트: IHC Recommended Applications)
Product Description
Polyclonal Antibody against Human PINK1
Alternative Gene Names
- PARK6
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | PTEN induced putative kinase 1 |
| Target Gene | PINK1 |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000015385 (87%), Mouse ENSMUSG00000028756 (85%) |
Antigen Information
| 항목 | 내용 |
|---|---|
| Antigen Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | GVDHLVQQGIAHRDLKSDNILVELDPDGCPWLVIADFGCCLADESIGLQLPFSSWYVDRGGNGCLMAPEVSTARPGPRAVIDYSKADAWAVGAIAYEIFGLVNPFYGQGKAHLESRSYQEAQLP |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide 첨가 (보존제) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용에 대한 최적 농도와 조건은 사용자가 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PILRB Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PINX1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PINK1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PINLYP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PIN4 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.