CacheBy
Atlas Antibodies Anti-PILRB Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PILRB Antibody

상품 한눈에 보기

인간 PILRB 단백질을 표적으로 하는 고품질 폴리클로날 항체입니다. Rabbit 유래 IgG 형식으로 제작되었으며, IHC 및 ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA026750-100 Anti-PILRB Antibody, paired immunoglobin-like type 2 receptor beta 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026750-25 Anti-PILRB Antibody, paired immunoglobin-like type 2 receptor beta 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PILRB Antibody

Anti-PILRB Antibody

Target: paired immunoglobin-like type 2 receptor beta
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human PILRB.


Alternative Gene Names

FDFACT1, FDFACT2

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein paired immunoglobin-like type 2 receptor beta
Target Gene PILRB
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence AGHPEIGEAAVAVHQGDQTHHHPGCHNHHHLEAQQHNHHSRPQGHRKQRALRIMAPKSGHCHQGCIGCRCAQNCHFGTAVPPPPVVEEKER
Verified Species Reactivity Human
Mouse Ortholog ENSMUSG00000034312 (27%)
Rat Ortholog ENSRNOG00000008622 (25%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative.
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.