
Atlas Antibodies Anti-PIK3CG Antibody
상품 한눈에 보기
Human PIK3CG 단백질을 타겟으로 하는 Rabbit Polyclonal IgG 항체로, Affinity purification 방식으로 정제됨. ICC 등 다양한 응용 가능. 40% glycerol 및 PBS buffer에 보존되며 sodium azide 포함. 인간, 마우스, 랫트 간 교차 반응성 확인됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PIK3CG Antibody
Target: phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit gamma
Supplier: Atlas Antibodies
Recommended Applications
- ICC (Immunocytochemistry)
- Additional applications to be optimized by user
Product Description
Polyclonal antibody against Human PIK3CG.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit gamma |
| Target Gene | PIK3CG |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (93%), Rat (93%) |
Antigen Sequence
KGKVQLLYYVNLLLIDHRFLLRRGEYVLHMWQISGKGEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPT
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PIK3CD Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PIK3CB Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PIK3CG Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PIK3R1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PIK3C2A Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.