
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PIK3C2A Antibody
상품 한눈에 보기
Human PIK3C2A 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 실험에 적합. PrEST 항원을 이용해 친화 정제됨. 높은 종간 보존성을 가지며, 40% 글리세롤 PBS 버퍼에 보존됨.
- 카탈로그번호
- HPA037641-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA037641-100 Anti-PIK3C2A Antibody, phosphatidylinositol-4-phosphate 3-kinase, catalytic subunit type 2 alpha 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037641-25 Anti-PIK3C2A Antibody, phosphatidylinositol-4-phosphate 3-kinase, catalytic subunit type 2 alpha 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PIK3C2A Antibody
Anti-PIK3C2A Antibody
Target: phosphatidylinositol-4-phosphate 3-kinase, catalytic subunit type 2 alpha
Type: Polyclonal Antibody against Human PIK3C2A
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human PIK3C2A, purified using the PrEST antigen as affinity ligand.
Alternative Gene Names
- PI3K-C2alpha
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | phosphatidylinositol-4-phosphate 3-kinase, catalytic subunit type 2 alpha |
| Target Gene | PIK3C2A |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | PRMPTFPSTEPIYLSLPGQSPYFSYPLTPATPFHPQGSLPIYRPVVSTDMAKLFDKIASTSEFLKNGKARTDLEITDSKVSNLQVSPKSE |
| Verified Species Reactivity | Human |
| Ortholog Identity | Rat ENSRNOG00000020479 (88%), Mouse ENSMUSG00000030660 (86%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



