
Atlas Antibodies Anti-PI16 Antibody
상품 한눈에 보기
인간 PI16 단백질을 인식하는 폴리클로날 항체로, Rabbit 유래 IgG 형식입니다. WB 등 다양한 응용에 적합하며, PrEST 항원으로 정제되었습니다. PBS 기반 버퍼와 sodium azide 보존제가 포함되어 있습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PI16 Antibody
Target: Peptidase inhibitor 16 (PI16)
Supplier: Atlas Antibodies
Recommended Applications
Western Blot (WB)
Product Description
Polyclonal Antibody against Human PI16
Alternative Gene Names
- dJ90K10.5
- MGC45378
- MSMBBP
Target Information
- Target Protein: Peptidase inhibitor 16
- Target Gene: PI16
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
CEPIGSPEDAQDLPYLVTEAPSFRATEASDSRKMGTPSSLATGIPAFLVTEVSGSLATKALPAVETQAPTSLATKDPPSMATEAPPCVT
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000024011 (61%)
- Rat ENSRNOG00000000525 (53%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
