원본
Atlas Antibodies Anti-PI16 Antibody
상품 한눈에 보기
인간 PI16 단백질을 인식하는 폴리클로날 항체로, Rabbit 유래 IgG 형식입니다. WB 등 다양한 응용에 적합하며, PrEST 항원으로 정제되었습니다. PBS 기반 버퍼와 sodium azide 보존제가 포함되어 있습니다.
- 카탈로그번호
- HPA076574-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA076574-100 Anti-PI16 Antibody, peptidase inhibitor 16 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA076574-25 Anti-PI16 Antibody, peptidase inhibitor 16 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PI16 Antibody
Anti-PI16 Antibody
Target: Peptidase inhibitor 16 (PI16)
Supplier: Atlas Antibodies
Recommended Applications
Western Blot (WB)
Product Description
Polyclonal Antibody against Human PI16
Alternative Gene Names
- dJ90K10.5
- MGC45378
- MSMBBP
Target Information
- Target Protein: Peptidase inhibitor 16
- Target Gene: PI16
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
CEPIGSPEDAQDLPYLVTEAPSFRATEASDSRKMGTPSSLATGIPAFLVTEVSGSLATKALPAVETQAPTSLATKDPPSMATEAPPCVT
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000024011 (61%)
- Rat ENSRNOG00000000525 (53%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.