Atlas Antibodies Anti-PI15 Antibody

상품 한눈에 보기

Human PI15 단백질을 인식하는 토끼 폴리클로날 항체로, IHC와 Western Blot에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. Human에 반응하며, Mouse 및 Rat과도 높은 서열 유사성을 가집니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA006593-100 Anti-PI15 Antibody, peptidase inhibitor 15 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA006593-25 Anti-PI15 Antibody, peptidase inhibitor 15 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Peptidase inhibitor 15 (PI15)
Type: Polyclonal Antibody against Human PI15
Supplier: Atlas Antibodies

Polyclonal antibody raised in rabbit against human peptidase inhibitor 15 (PI15), purified using the PrEST antigen as affinity ligand.

항목	내용
Target Protein	Peptidase inhibitor 15
Target Gene	PI15
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	LLFSLLCEASTVVLLNSTDSSPPTNNFTDIEAALKAQLDSADIPKARRKRYISQNDMIAILDYHNQVRGKVFPPAANMEYMVWDENLAKSAEAWAATCIWDHGPSYLLRFLGQNLSVRTGRYRSILQLVKPWYDEVKDY
Verified Species Reactivity	Human
Interspecies Identity	Mouse (92%), Rat (89%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)