CacheBy
Atlas Antibodies Anti-PGLYRP2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PGLYRP2 Antibody

상품 한눈에 보기

Human PGLYRP2 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. Affinity purification으로 높은 특이성과 순도 제공. IHC 등 다양한 응용에 적합. PBS/glycerol buffer로 안정화되어 장기 보관 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA075237-100 Anti-PGLYRP2 Antibody, peptidoglycan recognition protein 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA075237-25 Anti-PGLYRP2 Antibody, peptidoglycan recognition protein 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PGLYRP2 Antibody

Anti-PGLYRP2 Antibody

Target Information

  • Target Protein: Peptidoglycan recognition protein 2
  • Target Gene: PGLYRP2
  • Alternative Gene Names: PGLYRPL, PGRP-L, PGRPL, tagL, tagL-alpha, tagl-beta, TAGL-like

Product Description

Polyclonal antibody against human PGLYRP2.

Immunohistochemistry (IHC)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    VWGTLVLLQRLEPVHLQLQCMSQEQLAQVAANATKEFTEAFLGCPAIHPRCRWGAAPYRGRPKLLQLPLGFLYVHHTYVP

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000079563): 85%
  • Rat (ENSRNOG00000042318): 81%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Notes

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.