AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PGLYRP1 Antibody
상품 한눈에 보기
Human PGLYRP1을 표적으로 하는 토끼 폴리클로날 항체로, IHC 및 RNA-seq 데이터 비교를 통한 Orthogonal 검증 완료. PrEST 항원 기반 Affinity 정제, 높은 특이성과 재현성을 제공. 40% 글리세롤 및 PBS 버퍼에 보존제 포함.
- 카탈로그번호
- HPA070227-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA070227-100 Anti-PGLYRP1 Antibody, peptidoglycan recognition protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA070227-25 Anti-PGLYRP1 Antibody, peptidoglycan recognition protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PGLYRP1 Antibody
Anti-PGLYRP1 Antibody
Target: Peptidoglycan Recognition Protein 1 (PGLYRP1)
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human PGLYRP1
Alternative Gene Names
PGLYRP, PGRP, PGRP-S, PGRPS, TAG7, TNFSF3L
Antigen Information
- Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
PMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQN
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000030413 | 71% |
| Rat | ENSRNOG00000013395 | 68% |
Technical Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.