Atlas Antibodies Anti-PFKFB4 Antibody
상품 한눈에 보기
인간 PFKFB4 단백질에 특이적인 폴리클로날 항체로, 면역세포화학 등 다양한 응용에 적합합니다. 토끼 유래 IgG 항체이며 PrEST 항원으로 친화 정제되었습니다. 인간에 대한 반응성이 검증되었으며, 마우스 및 랫트와 높은 서열 유사성을 가집니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PFKFB4 Antibody
Target Information
- Target Protein: 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4
- Target Gene: PFKFB4
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
RELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLI
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000025648) — 97%
- Rat (ENSRNOG00000020656) — 97%
Product Description
Polyclonal antibody against human PFKFB4.
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Recommended Applications
면역세포화학(ICC) 등 다양한 면역학적 분석에 적합합니다.
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적 농도와 조건은 사용자에 의해 결정되어야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Atlas Antibodies
Atlas Antibodies Anti-PFKP Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-PFKL Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-PFKFB4 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-PFKFB4 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-PFKFB3 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.