Atlas Antibodies Anti-PFKFB4 Antibody

상품 한눈에 보기

인간 PFKFB4 단백질에 특이적인 폴리클로날 항체로, 면역세포화학 등 다양한 응용에 적합합니다. 토끼 유래 IgG 항체이며 PrEST 항원으로 친화 정제되었습니다. 인간에 대한 반응성이 검증되었으며, 마우스 및 랫트와 높은 서열 유사성을 가집니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA066058-100 Anti-PFKFB4 Antibody, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA066058-25 Anti-PFKFB4 Antibody, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4
Target Gene: PFKFB4
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
```
RELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLI
```

Highest antigen sequence identity to the following orthologs:

Polyclonal antibody against human PFKFB4.

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand