
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PFKFB4 Antibody
상품 한눈에 보기
인간 PFKFB4 단백질에 특이적인 폴리클로날 항체로, 면역세포화학 등 다양한 응용에 적합합니다. 토끼 유래 IgG 항체이며 PrEST 항원으로 친화 정제되었습니다. 인간에 대한 반응성이 검증되었으며, 마우스 및 랫트와 높은 서열 유사성을 가집니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA066058-100 Anti-PFKFB4 Antibody, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA066058-25 Anti-PFKFB4 Antibody, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PFKFB4 Antibody
Anti-PFKFB4 Antibody
Target Information
- Target Protein: 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4
- Target Gene: PFKFB4
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
RELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLI
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000025648) — 97%
- Rat (ENSRNOG00000020656) — 97%
Product Description
Polyclonal antibody against human PFKFB4.
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Recommended Applications
면역세포화학(ICC) 등 다양한 면역학적 분석에 적합합니다.
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적 농도와 조건은 사용자에 의해 결정되어야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



