CacheBy
Atlas Antibodies Anti-PFKFB4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PFKFB4 Antibody

상품 한눈에 보기

인간 PFKFB4 단백질에 특이적인 폴리클로날 항체로, 면역세포화학 등 다양한 응용에 적합합니다. 토끼 유래 IgG 항체이며 PrEST 항원으로 친화 정제되었습니다. 인간에 대한 반응성이 검증되었으며, 마우스 및 랫트와 높은 서열 유사성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA066058-100 Anti-PFKFB4 Antibody, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA066058-25 Anti-PFKFB4 Antibody, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PFKFB4 Antibody

Anti-PFKFB4 Antibody

Target Information

  • Target Protein: 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4
  • Target Gene: PFKFB4
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    RELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLI

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000025648) — 97%
  • Rat (ENSRNOG00000020656) — 97%

Product Description

Polyclonal antibody against human PFKFB4.

Open Datasheet

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

면역세포화학(ICC) 등 다양한 면역학적 분석에 적합합니다.

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적 농도와 조건은 사용자에 의해 결정되어야 합니다.

제품 이미지

Recommended Applications Icon

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.