AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PDX1 Antibody
상품 한눈에 보기
인체 PDX1 단백질을 표적으로 하는 고품질 폴리클로날 항체로, IHC 및 ICC 응용에 적합. 토끼 유래 IgG 항체이며 PrEST 항원으로 친화 정제됨. 인간에 대한 검증된 반응성과 정교한 정제 버퍼 구성으로 재현성 높은 결과 제공.
- 카탈로그번호
- HPA059146-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA059146-100 Anti-PDX1 Antibody, pancreatic and duodenal homeobox 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059146-25 Anti-PDX1 Antibody, pancreatic and duodenal homeobox 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PDX1 Antibody
Anti-PDX1 Antibody
Target: Pancreatic and duodenal homeobox 1 (PDX1)
Supplier: Atlas Antibodies
Recommended Applications
- IHC Orthogonal Validation: Protein expression validated by comparison to RNA-seq data in high and low expression tissues.
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human PDX1.
Alternative Gene Names
IDX-1, IPF1, MODY4, PDX-1, STF-1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Pancreatic and duodenal homeobox 1 |
| Target Gene | PDX1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (88%), Rat (84%) |
Antigen Sequence:
DISPYEVPPLADDPAVAHLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFPWMKSTKA
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.