
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PDSS2 Antibody
상품 한눈에 보기
Human PDSS2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. Human, Mouse, Rat에 반응.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA029685-100 Anti-PDSS2 Antibody, prenyl (decaprenyl) diphosphate synthase, subunit 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029685-25 Anti-PDSS2 Antibody, prenyl (decaprenyl) diphosphate synthase, subunit 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PDSS2 Antibody
Anti-PDSS2 Antibody
Target: prenyl (decaprenyl) diphosphate synthase, subunit 2 (PDSS2)
Type: Polyclonal Antibody against Human PDSS2
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Rabbit polyclonal antibody targeting human PDSS2 protein, purified by affinity using the PrEST antigen.
Alternative Gene Names
bA59I9.3, C6orf210
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | prenyl (decaprenyl) diphosphate synthase, subunit 2 |
| Target Gene | PDSS2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | FIKEKTSDSMTFNLNSAPVVLHQEFLGRDLWIKQIGEAQEKGRLDYAKLRERIKAGKGVTSAIDLCRY |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Rat ENSRNOG00000042962 (91%), Mouse ENSMUSG00000038240 (90%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using PrEST antigen |
| Storage Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Material Safety Data Sheet (MSDS)
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



