
Atlas Antibodies Anti-PDCL Antibody
상품 한눈에 보기
인간 PDCL 단백질에 대한 고특이성 폴리클로날 항체로 IHC, WB, ICC 등 다양한 응용에 적합. 재조합 발현 검증 완료. 토끼 유래 IgG 항체로 높은 순도와 안정성을 제공. PBS와 글리세롤 완충액에 보존 처리됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PDCL Antibody
phosducin-like
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) — Recombinant expression validation using target protein overexpression
- Immunocytochemistry (ICC)
Product Description
Polyclonal Antibody against Human PDCL
Alternative Gene Names
DKFZp564M1863, PhLP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | phosducin-like |
| Target Gene | PDCL |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | EISSGEGFLDMIDKEQKSIVIMVHIYEDGIPGTEAMNGCMICLAAEYPAVKFCKVK |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000009030 (88%), Rat ENSRNOG00000008484 (88%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
