CacheBy
Atlas Antibodies Anti-PDCD7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PDCD7 Antibody

상품 한눈에 보기

Human PDCD7 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 실험에 적합합니다. Rabbit 호스트에서 생산되었으며, PrEST 항원으로 친화 정제되었습니다. 높은 인간 특이성과 마우스·랫트 교차 반응성을 보입니다.

카탈로그번호
HPA049388-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049388-100 Anti-PDCD7 Antibody, programmed cell death 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049388-25 Anti-PDCD7 Antibody, programmed cell death 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PDCD7 Antibody

Anti-PDCD7 Antibody

Target Information

  • Target Protein: Programmed cell death 7
  • Target Gene: PDCD7
  • Alternative Gene Names: ES18, HES18

Product Description

Polyclonal antibody against human PDCD7.

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    RWRVKCVQEVEEKKREQELKAAADGVLSEVRKKQADTKRMVDILRALEKLRKLRKEAAARKGVCPPASADETFTHHLQRL

Species Reactivity

  • Verified Species: Human
  • Interspecies Information:
    • Mouse (ENSMUSG00000041837) – 96% identity
    • Rat (ENSRNOG00000014340) – 94% identity

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Datasheet

Open Datasheet (PDF)

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.