
Atlas Antibodies Anti-PCYT2 Antibody
상품 한눈에 보기
인간 PCYT2 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB 검증에 적합합니다. Rabbit 유래 IgG이며, PrEST 항원으로 친화 정제되었습니다. 사람 및 랫드 반응성이 확인되었으며, 높은 종간 서열 유사성을 보입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PCYT2 Antibody
Target: phosphate cytidylyltransferase 2, ethanolamine
Type: Polyclonal Antibody against Human PCYT2
Recommended Applications
- IHC Independent Validation
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. - WB Independent Validation
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against human PCYT2.
Alternative Gene Names
ET
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | phosphate cytidylyltransferase 2, ethanolamine |
| Target Gene | PCYT2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human, Rat |
| Interspecies Information | Mouse ENSMUSG00000025137 (99%), Rat ENSRNOG00000036684 (96%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Antigen Sequence
LDKYNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLVTKAHHSSQEMSSEYREYADSFGKCPGOpen Datasheet
Material Safety Data Sheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PCYT1B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PDAP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PCYT2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PCYT2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PCYOX1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.