CacheBy
Atlas Antibodies Anti-PCYT2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PCYT2 Antibody

상품 한눈에 보기

인간 PCYT2 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB 검증에 적합합니다. Rabbit 유래 IgG이며, PrEST 항원으로 친화 정제되었습니다. 사람 및 랫드 반응성이 확인되었으며, 높은 종간 서열 유사성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA023034-100 Anti-PCYT2 Antibody, phosphate cytidylyltransferase 2, ethanolamine 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023034-25 Anti-PCYT2 Antibody, phosphate cytidylyltransferase 2, ethanolamine 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PCYT2 Antibody

Anti-PCYT2 Antibody

Target: phosphate cytidylyltransferase 2, ethanolamine
Type: Polyclonal Antibody against Human PCYT2


  • IHC Independent Validation
    Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB Independent Validation
    Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal antibody against human PCYT2.


Alternative Gene Names

ET


Target Information

항목 내용
Target Protein phosphate cytidylyltransferase 2, ethanolamine
Target Gene PCYT2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human, Rat
Interspecies Information Mouse ENSMUSG00000025137 (99%), Rat ENSRNOG00000036684 (96%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


Antigen Sequence

LDKYNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLVTKAHHSSQEMSSEYREYADSFGKCPG

Open Datasheet
Material Safety Data Sheet


제품 이미지

Enhanced Validation
IHC Independent Validation
WB Independent Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.