CacheBy
Atlas Antibodies Anti-PCYT2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PCYT2 Antibody

상품 한눈에 보기

Human PCYT2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에서 독립 항체 검증 완료. 높은 종간 보존성(마우스 99%, 랫 96%)을 가지며, PrEST 항원으로 친화 정제됨. 40% 글리세롤 기반 PBS 버퍼에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA023033-100 Anti-PCYT2 Antibody, phosphate cytidylyltransferase 2, ethanolamine 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023033-25 Anti-PCYT2 Antibody, phosphate cytidylyltransferase 2, ethanolamine 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PCYT2 Antibody

Anti-PCYT2 Antibody

Target: phosphate cytidylyltransferase 2, ethanolamine (PCYT2)
Type: Polyclonal Antibody against Human PCYT2


  • IHC (Immunohistochemistry)
    Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Western Blot)
    Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal antibody raised in rabbit against human phosphate cytidylyltransferase 2, ethanolamine (PCYT2).


Alternative Gene Names

  • ET

Target Information

항목 내용
Target Protein phosphate cytidylyltransferase 2, ethanolamine
Target Gene PCYT2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence LDKYNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLVTKAHHSSQEMSSEYREYADSFGKCPG
Verified Species Reactivity Human, Rat
Interspecies Identity Mouse ENSMUSG00000025137 (99%), Rat ENSRNOG00000036684 (96%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources


제품 이미지

Enhanced Validation
IHC Independent Validation
WB Independent Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.