
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PCYT2 Antibody
상품 한눈에 보기
Human PCYT2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에서 독립 항체 검증 완료. 높은 종간 보존성(마우스 99%, 랫 96%)을 가지며, PrEST 항원으로 친화 정제됨. 40% 글리세롤 기반 PBS 버퍼에 보존제 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA023033-100 Anti-PCYT2 Antibody, phosphate cytidylyltransferase 2, ethanolamine 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023033-25 Anti-PCYT2 Antibody, phosphate cytidylyltransferase 2, ethanolamine 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PCYT2 Antibody
Anti-PCYT2 Antibody
Target: phosphate cytidylyltransferase 2, ethanolamine (PCYT2)
Type: Polyclonal Antibody against Human PCYT2
Recommended Applications
- IHC (Immunohistochemistry)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. - WB (Western Blot)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody raised in rabbit against human phosphate cytidylyltransferase 2, ethanolamine (PCYT2).
Alternative Gene Names
- ET
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | phosphate cytidylyltransferase 2, ethanolamine |
| Target Gene | PCYT2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | LDKYNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLVTKAHHSSQEMSSEYREYADSFGKCPG |
| Verified Species Reactivity | Human, Rat |
| Interspecies Identity | Mouse ENSMUSG00000025137 (99%), Rat ENSRNOG00000036684 (96%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



