
Atlas Antibodies Anti-PCYT2 Antibody
상품 한눈에 보기
Human PCYT2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에서 독립 항체 검증 완료. 높은 종간 보존성(마우스 99%, 랫 96%)을 가지며, PrEST 항원으로 친화 정제됨. 40% 글리세롤 기반 PBS 버퍼에 보존제 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PCYT2 Antibody
Target: phosphate cytidylyltransferase 2, ethanolamine (PCYT2)
Type: Polyclonal Antibody against Human PCYT2
Recommended Applications
- IHC (Immunohistochemistry)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. - WB (Western Blot)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody raised in rabbit against human phosphate cytidylyltransferase 2, ethanolamine (PCYT2).
Alternative Gene Names
- ET
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | phosphate cytidylyltransferase 2, ethanolamine |
| Target Gene | PCYT2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | LDKYNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLVTKAHHSSQEMSSEYREYADSFGKCPG |
| Verified Species Reactivity | Human, Rat |
| Interspecies Identity | Mouse ENSMUSG00000025137 (99%), Rat ENSRNOG00000036684 (96%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PDAP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PCYT2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PCYT2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PCYOX1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PCYT1A Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.