
원본
Atlas Antibodies Anti-C1orf27 Antibody
상품 한눈에 보기
Human C1orf27 단백질을 인식하는 고품질 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. Rabbit 유래 IgG, PrEST 항원으로 친화 정제됨. 인간에 대해 검증된 반응성 보유.
- 카탈로그번호
- HPA031352-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA031352-100 Anti-C1orf27 Antibody, chromosome 1 open reading frame 27 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031352-25 Anti-C1orf27 Antibody, chromosome 1 open reading frame 27 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C1orf27 Antibody
Anti-C1orf27 Antibody
Target: chromosome 1 open reading frame 27 (C1orf27)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human C1orf27.
Alternative Gene Names
FLJ20505, odr-4, TTG1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 1 open reading frame 27 |
| Target Gene | C1orf27 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | FHVLPYRVFVPLPGSTVMLCDYKFDDESAEEIRDHFMEMLDHTIQIEDLEIAEETNTACMSSSMNSQASLDNTDDEQPKQPIK |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000006010 (81%)
- Rat ENSRNOG00000002473 (78%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



