CacheBy
Atlas Antibodies Anti-C1orf27 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C1orf27 Antibody

상품 한눈에 보기

Human C1orf27 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공. Human에 반응하며, Mouse 및 Rat과도 높은 서열 유사성을 가짐.

카탈로그번호
HPA015988-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA015988-100 Anti-C1orf27 Antibody, chromosome 1 open reading frame 27 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA015988-25 Anti-C1orf27 Antibody, chromosome 1 open reading frame 27 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C1orf27 Antibody

Anti-C1orf27 Antibody

Target: chromosome 1 open reading frame 27 (C1orf27)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human C1orf27 protein.


Alternative Gene Names

FLJ20505, odr-4, TTG1

Open Datasheet (PDF)


Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Sequence:
FHVLPYRVFVPLPGSTVMLCDYKFDDESAEEIRDHFMEMLDHTIQIEDLEIAEETNTACMSSSMNSQASLDNTDDEQPKQPIK


Species Reactivity

  • Verified: Human
  • Orthologs:
    • Mouse (ENSMUSG00000006010, 81%)
    • Rat (ENSRNOG00000002473, 78%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 실험 응용에 맞는 최적 조건은 사용자가 직접 설정해야 합니다.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.