
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-C1orf27 Antibody
상품 한눈에 보기
Human C1orf27 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공. Human에 반응하며, Mouse 및 Rat과도 높은 서열 유사성을 가짐.
- 카탈로그번호
- HPA015988-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA015988-100 Anti-C1orf27 Antibody, chromosome 1 open reading frame 27 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA015988-25 Anti-C1orf27 Antibody, chromosome 1 open reading frame 27 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C1orf27 Antibody
Anti-C1orf27 Antibody
Target: chromosome 1 open reading frame 27 (C1orf27)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human C1orf27 protein.
Alternative Gene Names
FLJ20505, odr-4, TTG1
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
FHVLPYRVFVPLPGSTVMLCDYKFDDESAEEIRDHFMEMLDHTIQIEDLEIAEETNTACMSSSMNSQASLDNTDDEQPKQPIK
Species Reactivity
- Verified: Human
- Orthologs:
- Mouse (ENSMUSG00000006010, 81%)
- Rat (ENSRNOG00000002473, 78%)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 실험 응용에 맞는 최적 조건은 사용자가 직접 설정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



