CacheBy
Atlas Antibodies Anti-C1orf204 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C1orf204 Antibody

상품 한눈에 보기

Human C1orf204 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 연구 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. Human 시료에 검증됨.

카탈로그번호
HPA051028-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051028-100 Anti-C1orf204 Antibody, chromosome 1 open reading frame 204 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051028-25 Anti-C1orf204 Antibody, chromosome 1 open reading frame 204 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C1orf204 Antibody

Anti-C1orf204 Antibody

Target: chromosome 1 open reading frame 204 (C1orf204)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human C1orf204 protein.


Alternative Gene Names

  • FLJ39187

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 1 open reading frame 204
Target Gene C1orf204
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GLLVSSPHCEEPCAHSCAHPGLPPHLVHKLPLSYLQTQDTDAASRRINAPLAAGWSWLRLWLVT

Species Reactivity

  • Verified Species: Human
  • Interspecies Identity:
    • Rat ENSRNOG00000014293 (31%)
    • Mouse ENSMUSG00000031661 (29%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications Icon - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.