Atlas Antibodies Anti-C1orf174 Antibody

상품 한눈에 보기

Human C1orf174 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 반응하며 Rat 및 Mouse와 63% 상동성을 가집니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA008270-100 Anti-C1orf174 Antibody, chromosome 1 open reading frame 174 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA008270-25 Anti-C1orf174 Antibody, chromosome 1 open reading frame 174 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: chromosome 1 open reading frame 174 (C1orf174)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG

Polyclonal antibody against Human C1orf174, generated using a PrEST recombinant protein antigen.

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

VSDSRLAKTRDGLSVPKHSAGSGAEESNSSSTVQKQNEPGLQTEDVQKPPLQMDNSVFLDDDSNQPMPVSRFFGNVELMQDLPPASSSCPSMSRREFRKMHFRAKDDDDDDDDD

Species	Gene ID	Sequence Identity
Rat	ENSRNOG00000025034	63%
Mouse	ENSMUSG00000047613	63%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Storage	Store at recommended conditions. Gently mix before use.
Notes	Optimal concentrations and conditions should be determined by the user.
MSDS	Material Safety Data Sheet