CacheBy
Atlas Antibodies Anti-C1orf21 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C1orf21 Antibody

상품 한눈에 보기

인간 C1orf21 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 재조합 단백질 발현 검증 완료. 고순도 Affinity 정제 및 안정한 글리세롤 버퍼 제공.

카탈로그번호
HPA026831-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA026831-100 Anti-C1orf21 Antibody, chromosome 1 open reading frame 21 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026831-25 Anti-C1orf21 Antibody, chromosome 1 open reading frame 21 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C1orf21 Antibody

Anti-C1orf21 Antibody

Target: chromosome 1 open reading frame 21 (C1orf21)
Type: Polyclonal Antibody against Human C1orf21
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) — Recombinant expression validation using target protein overexpression
  • Immunocytochemistry (ICC)

Alternative Gene Names

  • PIG13

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 1 open reading frame 21
Target Gene C1orf21
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence AKHVATVQNEEEAQKGKNYQNGDVFGDEYRIKPVEEVKYMKNGAEEEQKIAARNQENLEKSASSNVRLKTNKEVPGLVHQPRANMHISESQQEFFRMLDEKIEKGRDYCSEE
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000028236 (96%), Mouse ENSMUSG00000032666 (96%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.