CacheBy
Atlas Antibodies Anti-C1orf216 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C1orf216 Antibody

상품 한눈에 보기

Human C1orf216 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 Western Blot에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. 인간에 반응하며, 마우스 및 랫과 유사 서열을 가집니다.

카탈로그번호
HPA028299-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028299-100 Anti-C1orf216 Antibody, chromosome 1 open reading frame 216 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028299-25 Anti-C1orf216 Antibody, chromosome 1 open reading frame 216 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C1orf216 Antibody

Anti-C1orf216 Antibody

Target: Chromosome 1 open reading frame 216 (C1orf216)
Type: Polyclonal Antibody against Human C1orf216


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

This product is a polyclonal antibody raised in rabbit against the human C1orf216 protein. It is affinity purified using the PrEST antigen as affinity ligand.


Alternative Gene Names

  • FLJ38984

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Chromosome 1 open reading frame 216
Target Gene C1orf216
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence MFAIQPGLAEGGQFLGDPPPGLCQPELQPDSNSNFMASAKDANENWHGMPGRVEPILRRSSSESPSDNQA
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000073755 (74%), Rat ENSRNOG00000048060 (71%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.