
Atlas Antibodies Anti-C1orf116 Antibody
상품 한눈에 보기
Human C1orf116 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. Orthogonal 및 Independent validation을 거쳐 신뢰성이 높으며, PrEST 항원으로 친화 정제되었습니다. 40% glycerol 기반 PBS buffer에 보존되어 있습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C1orf116 Antibody
Target: chromosome 1 open reading frame 116
Recommended Applications
- IHC (Orthogonal validation): 단백질 발현을 RNA-seq 데이터와 비교하여 고·저발현 조직에서 검증
- WB (Independent validation): 서로 다른 epitope을 타깃하는 독립 항체 간의 단백질 발현 비교를 통해 검증
Product Description
Polyclonal Antibody against Human C1orf116
Alternative Gene Names
FLJ36507, MGC2742, MGC4309, SARG
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 1 open reading frame 116 |
| Target Gene | C1orf116 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | ANSALTPPKPESGLTLQESNTPGLRQMNFKSNTLERSGVGLSSYLSTEKDASPKTSTSLGKGSFLDKISPSVLRNSRPRPASLGTGKDFAGIQVGKLADLEQEQSSKRLSYQGQSRDKLPRPPCVSVKISPKGVPNEHRREALKKLGLL |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000004341 (77%), Mouse ENSMUSG00000042510 (75%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자가 실험에 맞게 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C1orf162 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C1orf159 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C1orf116 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C1orf123 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C1orf112 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.