CacheBy
Atlas Antibodies Anti-C1orf123 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C1orf123 Antibody

상품 한눈에 보기

Human C1orf123 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. 재조합 발현 검증 완료. PrEST 항원을 이용한 친화 정제. 인간에 대한 반응성 검증됨.

카탈로그번호
HPA043835-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043835-100 Anti-C1orf123 Antibody, chromosome 1 open reading frame 123 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043835-25 Anti-C1orf123 Antibody, chromosome 1 open reading frame 123 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C1orf123 Antibody

Anti-C1orf123 Antibody

Target: chromosome 1 open reading frame 123 (C1orf123)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB, Recombinant Expression validation)
  • Immunocytochemistry (ICC)

Recombinant expression validation in WB using target protein overexpression.


Product Description

Polyclonal antibody against human C1orf123.


Alternative Gene Names

  • FLJ20580

Open Datasheet


Target Information

항목 내용
Target Protein chromosome 1 open reading frame 123
Target Gene C1orf123
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence IALQLKATLENITNLRPVGEDFRWYLKMKCGNCGEISDKWQYIRLMDSVALKGGRGSASMVQKCKLCARE

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000028608 97%
Rat ENSRNOG00000012724 97%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.