CacheBy
Atlas Antibodies Anti-C1orf131 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C1orf131 Antibody

상품 한눈에 보기

인간 C1orf131 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 인간에 반응하며 쥐, 랫드와 부분적 교차 반응 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA029920-100 Anti-C1orf131 Antibody, chromosome 1 open reading frame 131 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029920-25 Anti-C1orf131 Antibody, chromosome 1 open reading frame 131 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C1orf131 Antibody

Anti-C1orf131 Antibody

Target: chromosome 1 open reading frame 131 (C1orf131)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot, independent validation)
    Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human C1orf131.


Alternative Gene Names

  • DKFZp547B1713

Target Information

항목 내용
Target Protein chromosome 1 open reading frame 131
Target Gene C1orf131
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence ADPTMSQEQGPGSSTPPSSPTLLDALLQNLYDFGGTEGETEQKKIIKKRENKKRDVMASAALAAEPSPLPGS

Species Reactivity

항목 내용
Verified Species Human
Ortholog Identity Rat ENSRNOG00000019169 (54%), Mouse ENSMUSG00000031984 (51%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 농도 / 조건
Buffer PBS (pH 7.2)
Glycerol 40%
Preservative 0.02% Sodium azide (Material Safety Data Sheet)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적 농도와 조건은 사용자가 직접 결정해야 합니다.

Reference

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC
WB
Independent Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.