
Atlas Antibodies Anti-C1orf131 Antibody
상품 한눈에 보기
인간 C1orf131 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 인간에 반응하며 쥐, 랫드와 부분적 교차 반응 가능.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C1orf131 Antibody
Target: chromosome 1 open reading frame 131 (C1orf131)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, independent validation)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. - ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human C1orf131.
Alternative Gene Names
- DKFZp547B1713
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 1 open reading frame 131 |
| Target Gene | C1orf131 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | ADPTMSQEQGPGSSTPPSSPTLLDALLQNLYDFGGTEGETEQKKIIKKRENKKRDVMASAALAAEPSPLPGS |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Species | Human |
| Ortholog Identity | Rat ENSRNOG00000019169 (54%), Mouse ENSMUSG00000031984 (51%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 성분 | 농도 / 조건 |
|---|---|
| Buffer | PBS (pH 7.2) |
| Glycerol | 40% |
| Preservative | 0.02% Sodium azide (Material Safety Data Sheet) |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적 농도와 조건은 사용자가 직접 결정해야 합니다.
Reference
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C1orf112 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C1orf127 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C1orf131 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C1orf145 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C1orf109 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.