CacheBy
Atlas Antibodies Anti-C1orf145 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C1orf145 Antibody

상품 한눈에 보기

Human C1orf145 단백질을 인식하는 고품질 rabbit polyclonal antibody. IHC 등 다양한 연구 응용에 적합. PrEST 항원을 이용해 affinity purification 수행. Human에 대한 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA046612-100 Anti-C1orf145 Antibody, chromosome 1 open reading frame 145 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046612-25 Anti-C1orf145 Antibody, chromosome 1 open reading frame 145 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C1orf145 Antibody

Anti-C1orf145 Antibody

Target: chromosome 1 open reading frame 145 (C1orf145)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against Human C1orf145.


Alternative Gene Names

  • FLJ31994

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 1 open reading frame 145
Target Gene C1orf145
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000030779 (28%), Rat ENSRNOG00000014530 (28%)

Epitope Sequence:
MYTASSSAETLRTVRRRSVPSSSMPYLALAHNRVSSLNHAASVDGWGTSHRNVADSFSRTSRSCSRFLKGTAGSARREDWNG


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.