CacheBy
Atlas Antibodies Anti-C1orf145 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C1orf145 Antibody

상품 한눈에 보기

Human C1orf145 단백질을 인식하는 고품질 rabbit polyclonal antibody. IHC 등 다양한 연구 응용에 적합. PrEST 항원을 이용해 affinity purification 수행. Human에 대한 반응성 검증 완료.

카탈로그번호
HPA046612-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046612-100 Anti-C1orf145 Antibody, chromosome 1 open reading frame 145 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046612-25 Anti-C1orf145 Antibody, chromosome 1 open reading frame 145 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C1orf145 Antibody

Anti-C1orf145 Antibody

Target: chromosome 1 open reading frame 145 (C1orf145)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against Human C1orf145.


Alternative Gene Names

  • FLJ31994

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 1 open reading frame 145
Target Gene C1orf145
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000030779 (28%), Rat ENSRNOG00000014530 (28%)

Epitope Sequence:
MYTASSSAETLRTVRRRSVPSSSMPYLALAHNRVSSLNHAASVDGWGTSHRNVADSFSRTSRSCSRFLKGTAGSARREDWNG


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.