CacheBy
Atlas Antibodies Anti-C1orf116 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C1orf116 Antibody

상품 한눈에 보기

인체 C1orf116 단백질을 타겟으로 한 폴리클로날 항체로, IHC 및 WB에 적합합니다. 독립적 및 오소고날 검증을 통해 높은 신뢰도를 보장하며, 토끼 유래 IgG 형태로 정제된 제품입니다. 인간 반응성 확인 및 다양한 유전자명으로 식별됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA011889-100 Anti-C1orf116 Antibody, chromosome 1 open reading frame 116 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA011889-25 Anti-C1orf116 Antibody, chromosome 1 open reading frame 116 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C1orf116 Antibody

Anti-C1orf116 Antibody

Target: chromosome 1 open reading frame 116
Supplier: Atlas Antibodies


  • Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal Antibody against Human C1orf116

Alternative Gene Names

FLJ36507, MGC2742, MGC4309, SARG

Open Datasheet


Specifications

항목 내용
Target Protein chromosome 1 open reading frame 116
Target Gene C1orf116
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000004341 (77%), Mouse ENSMUSG00000042510 (75%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

ANSALTPPKPESGLTLQESNTPGLRQMNFKSNTLERSGVGLSSYLSTEKDASPKTSTSLGKGSFLDKISPSVLRNSRPRPASLGTGKDFAGIQVGKLADLEQEQSSKRLSYQGQSRDKLPRPPCVSVKISPKGVPNEHRREALKKLGLL

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
WB Independent Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.