
Atlas Antibodies Anti-C1orf116 Antibody
상품 한눈에 보기
인체 C1orf116 단백질을 타겟으로 한 폴리클로날 항체로, IHC 및 WB에 적합합니다. 독립적 및 오소고날 검증을 통해 높은 신뢰도를 보장하며, 토끼 유래 IgG 형태로 정제된 제품입니다. 인간 반응성 확인 및 다양한 유전자명으로 식별됩니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C1orf116 Antibody
Target: chromosome 1 open reading frame 116
Supplier: Atlas Antibodies
Recommended Applications
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human C1orf116
Alternative Gene Names
FLJ36507, MGC2742, MGC4309, SARG
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 1 open reading frame 116 |
| Target Gene | C1orf116 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000004341 (77%), Mouse ENSMUSG00000042510 (75%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
Antigen Sequence
ANSALTPPKPESGLTLQESNTPGLRQMNFKSNTLERSGVGLSSYLSTEKDASPKTSTSLGKGSFLDKISPSVLRNSRPRPASLGTGKDFAGIQVGKLADLEQEQSSKRLSYQGQSRDKLPRPPCVSVKISPKGVPNEHRREALKKLGLL제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C1orf109 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C1orf131 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C1orf116 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C1orf112 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C1orf109 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.