CacheBy
Atlas Antibodies Anti-C1orf131 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C1orf131 Antibody

상품 한눈에 보기

Human C1orf131 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. 인간에 대한 검증된 반응성을 보유합니다.

카탈로그번호
HPA028452-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028452-100 Anti-C1orf131 Antibody, chromosome 1 open reading frame 131 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028452-25 Anti-C1orf131 Antibody, chromosome 1 open reading frame 131 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C1orf131 Antibody

Anti-C1orf131 Antibody

Target: chromosome 1 open reading frame 131
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Validation:
Independent antibody validation in WB comparing antibodies targeting different epitopes of the protein.


Product Description

Polyclonal Antibody against Human C1orf131


Alternative Gene Names

  • DKFZp547B1713

Open Datasheet (PDF)


Specifications

항목 내용
Target Protein chromosome 1 open reading frame 131
Target Gene C1orf131
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence ADPTMSQEQGPGSSTPPSSPTLLDALLQNLYDFGGTEGETEQKKIIKKRENKKRDVMASAALAAEPSPLPGS
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000019169 (54%), Mouse ENSMUSG00000031984 (51%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Material Safety Data Sheet

제품 이미지

Enhanced Validation
IHC Application
WB Independent Validation
Independent Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.