CacheBy
Atlas Antibodies Anti-C1orf131 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C1orf131 Antibody

상품 한눈에 보기

Human C1orf131 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. 인간에 대한 검증된 반응성을 보유합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA028452-100 Anti-C1orf131 Antibody, chromosome 1 open reading frame 131 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028452-25 Anti-C1orf131 Antibody, chromosome 1 open reading frame 131 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C1orf131 Antibody

Anti-C1orf131 Antibody

Target: chromosome 1 open reading frame 131
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Validation:
Independent antibody validation in WB comparing antibodies targeting different epitopes of the protein.


Product Description

Polyclonal Antibody against Human C1orf131


Alternative Gene Names

  • DKFZp547B1713

Open Datasheet (PDF)


Specifications

항목 내용
Target Protein chromosome 1 open reading frame 131
Target Gene C1orf131
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence ADPTMSQEQGPGSSTPPSSPTLLDALLQNLYDFGGTEGETEQKKIIKKRENKKRDVMASAALAAEPSPLPGS
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000019169 (54%), Mouse ENSMUSG00000031984 (51%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Material Safety Data Sheet

제품 이미지

Enhanced Validation
IHC Application
WB Independent Validation
Independent Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.