Atlas Antibodies Anti-C19orf47 Antibody

상품 한눈에 보기

Human C19orf47 단백질을 인식하는 rabbit polyclonal antibody. IHC, WB, ICC 등 다양한 응용에 적합. Recombinant PrEST 항원을 이용해 정제된 고품질 항체. Human 및 Rat 반응성 검증 완료.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA041843-100 Anti-C19orf47 Antibody, chromosome 19 open reading frame 47 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA041843-25 Anti-C19orf47 Antibody, chromosome 19 open reading frame 47 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: chromosome 19 open reading frame 47 (C19orf47)
Supplier: Atlas Antibodies

Polyclonal antibody against human C19orf47.

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
```
TVVGDIIAILKHAKVVHRQDMCKAATESVPCSPSPLAGEIRRGTSAASRMITNSLNHDSPPSTPPRRPDTSTSKISVT
```

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen as affinity ligand