CacheBy
Atlas Antibodies Anti-C19orf44 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C19orf44 Antibody

상품 한눈에 보기

Human C19orf44 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. 40% 글리세롤 기반 완충액에 보존되어 안정적입니다.

카탈로그번호
HPA049414-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049414-100 Anti-C19orf44 Antibody, chromosome 19 open reading frame 44 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049414-25 Anti-C19orf44 Antibody, chromosome 19 open reading frame 44 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C19orf44 Antibody

Anti-C19orf44 Antibody

Target: chromosome 19 open reading frame 44 (C19orf44)
Supplier: Atlas Antibodies

면역조직화학 (IHC) 등 다양한 연구 응용에 사용 가능

Product Description

Polyclonal antibody against human C19orf44 protein.

Alternative Gene Names

  • FLJ21742

Open Datasheet

Target Information

항목 내용
Target Protein chromosome 19 open reading frame 44
Target Gene C19orf44
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000023700 (54%), Mouse ENSMUSG00000052794 (53%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

SRNLTKIAPGHSRFLKRNQTLDEKHLLLKENPVLGSGPRLASCRPPTTASRIRANAALMKLAQLETRIMNRKLQRNLSDTESDSMT

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 맞는 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.