
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-C19orf25 Antibody
상품 한눈에 보기
Human C19orf25 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 및 WB 등 다양한 응용에 적합. PrEST 항원으로 특이적 정제되어 높은 특이성과 재현성 제공. Human에 반응하며 Mouse, Rat과 낮은 상동성 보유.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA050270-100 Anti-C19orf25 Antibody, chromosome 19 open reading frame 25 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050270-25 Anti-C19orf25 Antibody, chromosome 19 open reading frame 25 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C19orf25 Antibody
Anti-C19orf25 Antibody
Target: chromosome 19 open reading frame 25
Type: Polyclonal Antibody against Human C19orf25
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody produced in rabbit targeting the human C19orf25 protein.
Affinity purified using the PrEST antigen as the affinity ligand.
Alternative Gene Names
- FLJ36666
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 19 open reading frame 25 |
| Target Gene | C19orf25 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000020133 (45%), Rat ENSRNOG00000016399 (43%) |
Antigen Sequence:
GEQLYQQSRAYVAANQRLQQAGNVLRQRCELLQRAGEDLEREVAQMKQAALPAAEAASSG
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Storage Notes | Gently mix before use. Determine optimal concentration and conditions for each application. |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



