Atlas Antibodies Anti-C19orf25 Antibody

상품 한눈에 보기

Human C19orf25 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 및 WB 등 다양한 응용에 적합. PrEST 항원으로 특이적 정제되어 높은 특이성과 재현성 제공. Human에 반응하며 Mouse, Rat과 낮은 상동성 보유.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA050270-100 Anti-C19orf25 Antibody, chromosome 19 open reading frame 25 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA050270-25 Anti-C19orf25 Antibody, chromosome 19 open reading frame 25 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: chromosome 19 open reading frame 25
Type: Polyclonal Antibody against Human C19orf25

Polyclonal antibody produced in rabbit targeting the human C19orf25 protein.
Affinity purified using the PrEST antigen as the affinity ligand.

항목	내용
Target Protein	chromosome 19 open reading frame 25
Target Gene	C19orf25
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000020133 (45%), Rat ENSRNOG00000016399 (43%)

Antigen Sequence:
GEQLYQQSRAYVAANQRLQQAGNVLRQRCELLQRAGEDLEREVAQMKQAALPAAEAASSG

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Storage Notes	Gently mix before use. Determine optimal concentration and conditions for each application.