CacheBy
Atlas Antibodies Anti-C19orf25 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C19orf25 Antibody

상품 한눈에 보기

Human C19orf25 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 및 WB 등 다양한 응용에 적합. PrEST 항원으로 특이적 정제되어 높은 특이성과 재현성 제공. Human에 반응하며 Mouse, Rat과 낮은 상동성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA050270-100 Anti-C19orf25 Antibody, chromosome 19 open reading frame 25 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050270-25 Anti-C19orf25 Antibody, chromosome 19 open reading frame 25 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C19orf25 Antibody

Anti-C19orf25 Antibody

Target: chromosome 19 open reading frame 25
Type: Polyclonal Antibody against Human C19orf25


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody produced in rabbit targeting the human C19orf25 protein.
Affinity purified using the PrEST antigen as the affinity ligand.


Alternative Gene Names

  • FLJ36666

Target Information

항목 내용
Target Protein chromosome 19 open reading frame 25
Target Gene C19orf25
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000020133 (45%), Rat ENSRNOG00000016399 (43%)

Antigen Sequence:
GEQLYQQSRAYVAANQRLQQAGNVLRQRCELLQRAGEDLEREVAQMKQAALPAAEAASSG


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Storage Notes Gently mix before use. Determine optimal concentration and conditions for each application.

Material Safety Data Sheet

Open Datasheet


제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.