CacheBy
Atlas Antibodies Anti-C19orf24 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C19orf24 Antibody

상품 한눈에 보기

Human C19orf24 단백질을 표적으로 하는 폴리클로날 항체. IHC 및 ICC 응용에 적합. Rabbit 유래 IgG 항체로 높은 종간 반응 특이성 확보. Affinity purification 방식으로 높은 순도 보장.

카탈로그번호
HPA047026-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA047026-100 Anti-C19orf24 Antibody, chromosome 19 open reading frame 24 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047026-25 Anti-C19orf24 Antibody, chromosome 19 open reading frame 24 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C19orf24 Antibody

Anti-C19orf24 Antibody

Target: Chromosome 19 open reading frame 24 (C19orf24)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human C19orf24.


Alternative Gene Names

  • FLJ20640

Open Datasheet


Target Information

항목 내용
Target Protein Chromosome 19 open reading frame 24
Target Gene C19orf24
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000016193 (83%), Mouse ENSMUSG00000035595 (80%)

Antigen Sequence:
AFRLKKPQRRRYGLLANTEDPTEMASLDSDEETVFESRNL


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.