
Atlas Antibodies Anti-C16orf89 Antibody
상품 한눈에 보기
Human C16orf89 단백질을 인식하는 Rabbit Polyclonal 항체. IHC 등 독립적 검증을 통해 단백질 발현 확인에 적합. Affinity purification 방식으로 높은 특이성과 재현성 제공. Human에 반응하며 Rat, Mouse와도 높은 상동성 보유.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C16orf89 Antibody
Target: chromosome 16 open reading frame 89 (C16orf89)
Type: Polyclonal Antibody against Human C16orf89
Supplier: Atlas Antibodies
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody raised in rabbit against Human C16orf89.
Alternative Gene Names
- MGC45438
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 16 open reading frame 89 |
| Target Gene | C16orf89 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | KSVREKWAQEPLLQPLSLRVGMLGEKLEAAIQRSLHYLKLSDPKYLREFQLTLQPGFWKLPHAWIHTDASLVYPTFGPQDSFSEERSDVCLVQLLGTGTDSSEPCGLSDLCRSLMTKPGCSGYCLSHQLLFFLWA |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000021796 (73%), Mouse ENSMUSG00000051669 (70%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C17orf47 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C16orf87 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C16orf89 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C16orf86 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C16orf72 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.