
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-C16orf89 Antibody
상품 한눈에 보기
Human C16orf89 단백질을 인식하는 Rabbit Polyclonal 항체. IHC 등 독립적 검증을 통해 단백질 발현 확인에 적합. Affinity purification 방식으로 높은 특이성과 재현성 제공. Human에 반응하며 Rat, Mouse와도 높은 상동성 보유.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA016934-100 Anti-C16orf89 Antibody, chromosome 16 open reading frame 89 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA016934-25 Anti-C16orf89 Antibody, chromosome 16 open reading frame 89 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C16orf89 Antibody
Anti-C16orf89 Antibody
Target: chromosome 16 open reading frame 89 (C16orf89)
Type: Polyclonal Antibody against Human C16orf89
Supplier: Atlas Antibodies
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody raised in rabbit against Human C16orf89.
Alternative Gene Names
- MGC45438
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 16 open reading frame 89 |
| Target Gene | C16orf89 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | KSVREKWAQEPLLQPLSLRVGMLGEKLEAAIQRSLHYLKLSDPKYLREFQLTLQPGFWKLPHAWIHTDASLVYPTFGPQDSFSEERSDVCLVQLLGTGTDSSEPCGLSDLCRSLMTKPGCSGYCLSHQLLFFLWA |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000021796 (73%), Mouse ENSMUSG00000051669 (70%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



