Atlas Antibodies Anti-C16orf89 Antibody

상품 한눈에 보기

Human C16orf89 단백질을 인식하는 Rabbit Polyclonal 항체. IHC 등 독립적 검증을 통해 단백질 발현 확인에 적합. Affinity purification 방식으로 높은 특이성과 재현성 제공. Human에 반응하며 Rat, Mouse와도 높은 상동성 보유.

카탈로그번호: HPA016934-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA016934-100 Anti-C16orf89 Antibody, chromosome 16 open reading frame 89 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA016934-25 Anti-C16orf89 Antibody, chromosome 16 open reading frame 89 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-C16orf89 Antibody

Anti-C16orf89 Antibody

Target: chromosome 16 open reading frame 89 (C16orf89)
Type: Polyclonal Antibody against Human C16orf89
Supplier: Atlas Antibodies

Recommended Applications

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal antibody raised in rabbit against Human C16orf89.

Alternative Gene Names

MGC45438

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	chromosome 16 open reading frame 89
Target Gene	C16orf89
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	KSVREKWAQEPLLQPLSLRVGMLGEKLEAAIQRSLHYLKLSDPKYLREFQLTLQPGFWKLPHAWIHTDASLVYPTFGPQDSFSEERSDVCLVQLLGTGTDSSEPCGLSDLCRSLMTKPGCSGYCLSHQLLFFLWA
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000021796 (73%), Mouse ENSMUSG00000051669 (70%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand