CacheBy
Atlas Antibodies Anti-C16orf72 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C16orf72 Antibody

상품 한눈에 보기

Human C16orf72 단백질을 타깃으로 하는 폴리클로날 항체로, Rabbit 유래 IgG 형식입니다. IHC 및 WB에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 반응하며, Mouse 및 Rat에서도 높은 서열 동일성을 보입니다.

카탈로그번호
HPA041568-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041568-100 Anti-C16orf72 Antibody, chromosome 16 open reading frame 72 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041568-25 Anti-C16orf72 Antibody, chromosome 16 open reading frame 72 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C16orf72 Antibody

Anti-C16orf72 Antibody

Target: chromosome 16 open reading frame 72 (C16orf72)

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human C16orf72.

Alternative Gene Names

FLJ41272, PRO0149

Open Datasheet

Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

KLWHLFQNSATAVAQLYKDRVCQQPGLSLWVPFQNAATAVTNLYKESVDTHQRSFDIGIQIGYQRRNKDVLAWVKKRRRTIRREDLISFLC

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000022507 (100%)
  • Rat ENSRNOG00000002545 (100%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야별 최적 농도 및 조건은 사용자가 직접 확인해야 합니다.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.