CacheBy
Atlas Antibodies Anti-C16orf59 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C16orf59 Antibody

상품 한눈에 보기

Human C16orf59 단백질을 인식하는 Rabbit polyclonal 항체로, ICC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 인간에 대해 검증됨. 40% glycerol/PBS 완충액에 보존제로 sodium azide 포함.

카탈로그번호
HPA055389-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA055389-100 Anti-C16orf59 Antibody, chromosome 16 open reading frame 59 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055389-25 Anti-C16orf59 Antibody, chromosome 16 open reading frame 59 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C16orf59 Antibody

Anti-C16orf59 Antibody

Target: Chromosome 16 open reading frame 59 (C16orf59)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Verified Species Reactivity: Human


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human C16orf59, generated in rabbit using a recombinant PrEST antigen.


Alternative Gene Names

  • FLJ13909

Target Information

항목 내용
Target Protein Chromosome 16 open reading frame 59
Target Gene C16orf59
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Orthologs Mouse ENSMUSG00000024118 (64%), Rat ENSRNOG00000007436 (61%)

Antigen Sequence:
CSLLRLRMREELSAAPMDWMQEYRCLLTLEGLQAMVGQCLHRLQELRAAVAEQPPRPCPVGRPPGASPSCGGRAEPAWSPQLLVYSST


Purification Method

Affinity purified using the PrEST antigen as affinity ligand.


Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

Additional Resources

Open Datasheet (PDF)


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.