
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-C16orf59 Antibody
상품 한눈에 보기
Human C16orf59 단백질을 인식하는 Rabbit polyclonal 항체로, ICC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 인간에 대해 검증됨. 40% glycerol/PBS 완충액에 보존제로 sodium azide 포함.
- 카탈로그번호
- HPA055389-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA055389-100 Anti-C16orf59 Antibody, chromosome 16 open reading frame 59 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055389-25 Anti-C16orf59 Antibody, chromosome 16 open reading frame 59 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C16orf59 Antibody
Anti-C16orf59 Antibody
Target: Chromosome 16 open reading frame 59 (C16orf59)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Verified Species Reactivity: Human
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human C16orf59, generated in rabbit using a recombinant PrEST antigen.
Alternative Gene Names
- FLJ13909
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Chromosome 16 open reading frame 59 |
| Target Gene | C16orf59 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Orthologs | Mouse ENSMUSG00000024118 (64%), Rat ENSRNOG00000007436 (61%) |
Antigen Sequence:
CSLLRLRMREELSAAPMDWMQEYRCLLTLEGLQAMVGQCLHRLQELRAAVAEQPPRPCPVGRPPGASPSCGGRAEPAWSPQLLVYSST
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



