
Atlas Antibodies Anti-C16orf59 Antibody
Human C16orf59 단백질을 인식하는 Rabbit polyclonal 항체로, ICC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 인간에 대해 검증됨. 40% glycerol/PBS 완충액에 보존제로 sodium azide 포함.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C16orf59 Antibody
Target: Chromosome 16 open reading frame 59 (C16orf59)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Verified Species Reactivity: Human
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human C16orf59, generated in rabbit using a recombinant PrEST antigen.
Alternative Gene Names
- FLJ13909
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Chromosome 16 open reading frame 59 |
| Target Gene | C16orf59 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Orthologs | Mouse ENSMUSG00000024118 (64%), Rat ENSRNOG00000007436 (61%) |
Antigen Sequence:
CSLLRLRMREELSAAPMDWMQEYRCLLTLEGLQAMVGQCLHRLQELRAAVAEQPPRPCPVGRPPGASPSCGGRAEPAWSPQLLVYSST
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C16orf62 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C16orf70 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C16orf59 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C16orf62 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C16orf46 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|