CacheBy
Atlas Antibodies Anti-C16orf70 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C16orf70 Antibody

상품 한눈에 보기

인체 C16orf70 단백질을 인식하는 폴리클로날 항체로, Rabbit 유래 IgG 형식입니다. IHC 및 WB(재조합 발현 검증)에 적합하며, PrEST 항원을 이용해 친화정제되었습니다. 40% 글리세롤 및 PBS 완충액에 보존되어 안정적입니다.

카탈로그번호
HPA041131-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041131-100 Anti-C16orf70 Antibody, chromosome 16 open reading frame 70 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041131-25 Anti-C16orf70 Antibody, chromosome 16 open reading frame 70 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C16orf70 Antibody

Anti-C16orf70 Antibody

chromosome 16 open reading frame 70

  • Immunohistochemistry (IHC)
  • Western Blot (WB) — Recombinant expression validation using target protein overexpression

Product Description

Polyclonal antibody against human C16orf70.

Alternative Gene Names

  • C16orf6
  • FLJ12076
  • lin-10
  • LIN10

Open Datasheet

Target Information

항목 내용
Target Protein chromosome 16 open reading frame 70
Target Gene C16orf70
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000014668 (97%), Mouse ENSMUSG00000031889 (96%)

Antigen Sequence
HGATVKRMYIYSGNSLQDTKAPMMPLSCFLGNVYAESVDVLRDGTGPAGLRLRLLAAGCGPGLLADAKMRVFERSVYFGDSCQDVLSMLGSPHKVFYKS

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.