CacheBy
Atlas Antibodies Anti-C14orf2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C14orf2 Antibody

상품 한눈에 보기

Human C14orf2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC에 적합합니다. Orthogonal validation으로 RNA-seq 데이터와 비교 검증되었습니다. 높은 특이성과 재현성을 제공하며, PrEST 항원으로 정제되었습니다.

카탈로그번호
HPA058978-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA058978-100 Anti-C14orf2 Antibody, chromosome 14 open reading frame 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058978-25 Anti-C14orf2 Antibody, chromosome 14 open reading frame 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C14orf2 Antibody

Anti-C14orf2 Antibody

Target: chromosome 14 open reading frame 2 (C14orf2)
Supplier: Atlas Antibodies

Product Description

Polyclonal antibody against human C14orf2, validated for use in IHC and ICC applications. Orthogonal validation performed by comparison to RNA-seq data in high and low expression tissues.

Alternative Gene Names

  • MP68

Target Information

  • Target Protein: chromosome 14 open reading frame 2
  • Target Gene: C14orf2
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    PMKPYYTKVYQEIWIGMGLMGFIVYKIRAADKRSKALKASAPAPGHH

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000021290 81%
Rat ENSRNOG00000032130 76%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

Open Datasheet

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.