
Atlas Antibodies Anti-C14orf2 Antibody
상품 한눈에 보기
Human C14orf2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC에 적합합니다. Orthogonal validation으로 RNA-seq 데이터와 비교 검증되었습니다. 높은 특이성과 재현성을 제공하며, PrEST 항원으로 정제되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C14orf2 Antibody
Target: chromosome 14 open reading frame 2 (C14orf2)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human C14orf2, validated for use in IHC and ICC applications. Orthogonal validation performed by comparison to RNA-seq data in high and low expression tissues.
Alternative Gene Names
- MP68
Target Information
- Target Protein: chromosome 14 open reading frame 2
- Target Gene: C14orf2
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PMKPYYTKVYQEIWIGMGLMGFIVYKIRAADKRSKALKASAPAPGHH
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000021290 | 81% |
| Rat | ENSRNOG00000032130 | 76% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C14orf37 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C14orf79 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C14orf2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C14orf166 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C14orf28 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.