
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-C14orf2 Antibody
상품 한눈에 보기
Human C14orf2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC에 적합합니다. Orthogonal validation으로 RNA-seq 데이터와 비교 검증되었습니다. 높은 특이성과 재현성을 제공하며, PrEST 항원으로 정제되었습니다.
- 카탈로그번호
- HPA058978-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA058978-100 Anti-C14orf2 Antibody, chromosome 14 open reading frame 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058978-25 Anti-C14orf2 Antibody, chromosome 14 open reading frame 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C14orf2 Antibody
Anti-C14orf2 Antibody
Target: chromosome 14 open reading frame 2 (C14orf2)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human C14orf2, validated for use in IHC and ICC applications. Orthogonal validation performed by comparison to RNA-seq data in high and low expression tissues.
Alternative Gene Names
- MP68
Target Information
- Target Protein: chromosome 14 open reading frame 2
- Target Gene: C14orf2
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PMKPYYTKVYQEIWIGMGLMGFIVYKIRAADKRSKALKASAPAPGHH
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000021290 | 81% |
| Rat | ENSRNOG00000032130 | 76% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



