CacheBy
Atlas Antibodies Anti-C14orf159 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C14orf159 Antibody

상품 한눈에 보기

Human C14orf159 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합함. Rabbit에서 생산된 IgG 항체이며, PrEST 항원으로 정제됨. 인간 종에 대해 검증된 반응성을 보유.

카탈로그번호
HPA041423-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041423-100 Anti-C14orf159 Antibody, chromosome 14 open reading frame 159 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041423-25 Anti-C14orf159 Antibody, chromosome 14 open reading frame 159 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C14orf159 Antibody

Anti-C14orf159 Antibody

Target: Chromosome 14 open reading frame 159 (C14orf159)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human C14orf159.


Alternative Gene Names

  • FLJ39975

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Chromosome 14 open reading frame 159
Target Gene C14orf159
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat (74%), Mouse (72%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Antigen Sequence

AGAYKTTVPCVTHAGFCCPLVVTMRPIPKDKLEGLVRACCSLGGEQGQPVHMGDPELLGIKELSKPAYGDAMVCPPGEVPVFWPSPLTSLGAVSSCETPLA


Safety Information

Material Safety Data Sheet (Sodium Azide)


제품 이미지

IHC
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.