
Atlas Antibodies Anti-C12orf10 Antibody
상품 한눈에 보기
Human C12orf10 단백질을 표적으로 하는 Rabbit Polyclonal Antibody. IHC 및 ICC에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 보장. Glycerol/PBS buffer로 안정적 보관 가능.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C12orf10 Antibody
Target: Chromosome 12 open reading frame 10 (C12orf10)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human C12orf10.
Alternative Gene Names
- Gamm1
- MYG
- MYG1
Antigen Information
Antigen Sequence (Recombinant Protein Epitope Signature Tag, PrEST):
RYALTTTLSARVARLNPTWNHPDQDTEAGFKRAMDLVQEEFLQRLDFYQHSWLPARALVEEALAQRFQVDP
Verified Species Reactivity
- Human
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000013343 (92%)
- Mouse ENSMUSG00000001285 (90%)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C12orf49 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C12orf4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C12orf10 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C12orf29 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C11orf95 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.