CacheBy
Atlas Antibodies Anti-C12orf4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C12orf4 Antibody

상품 한눈에 보기

Human C12orf4 단백질을 인식하는 폴리클로날 항체로, IHC·WB·ICC 등 다양한 응용에 적합함. Rabbit에서 생산된 IgG 항체이며, PrEST 항원으로 친화 정제됨. 고순도, 높은 종간 특이성, 안정적인 PBS/glycerol buffer로 제공됨.

카탈로그번호
HPA037871-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA037871-100 Anti-C12orf4 Antibody, chromosome 12 open reading frame 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037871-25 Anti-C12orf4 Antibody, chromosome 12 open reading frame 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C12orf4 Antibody

Anti-C12orf4 Antibody

Target: chromosome 12 open reading frame 4 (C12orf4)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human C12orf4.

Open Datasheet


Target Information

항목 내용
Target Protein chromosome 12 open reading frame 4
Target Gene C12orf4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence KDLKEALTQFIEEESLSDYDRDAEASLAAVKSGEVDLHQLASTWAKAYAETTLEHARPEEPSWDEDFADVYHDLIHSPASETLLNLEHNYFVSISELIGER

Species Reactivity

항목 내용
Verified Species Human
Interspecies Homology Rat ENSRNOG00000055036 (91%), Mouse ENSMUSG00000030347 (89%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

항목 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.