CacheBy
Atlas Antibodies Anti-C11orf52 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C11orf52 Antibody

상품 한눈에 보기

인간 C11orf52 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 재조합 발현 검증을 통해 높은 특이성과 신뢰성을 제공합니다. 토끼 유래 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다.

카탈로그번호
HPA038387-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038387-100 Anti-C11orf52 Antibody, chromosome 11 open reading frame 52 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038387-25 Anti-C11orf52 Antibody, chromosome 11 open reading frame 52 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C11orf52 Antibody

Anti-C11orf52 Antibody

Target: chromosome 11 open reading frame 52 (C11orf52)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot, recombinant expression validation)
  • ICC (Immunocytochemistry)

Recombinant expression validation: Verified in WB using target protein overexpression.


Product Description

Polyclonal antibody against human C11orf52.


Alternative Gene Names

  • FLJ25219
  • MGC14839

Open Datasheet (PDF)


Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

MGNRVCCGGSWSCPSTFQKKKKTGSQTRRTLKPQPQQLQQNLPKGHETTGHTYERVLQQQGS

Verified Species Reactivity

  • Human

Interspecies Information:
| Species | Ortholog ID | Sequence Identity |
|----------|--------------|-------------------|
| Rat | ENSRNOG00000051792 | 65% |
| Mouse | ENSMUSG00000032062 | 63% |


Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.