
Atlas Antibodies Anti-C11orf1 Antibody
상품 한눈에 보기
Human C11orf1 단백질을 인식하는 Rabbit Polyclonal 항체. IHC, WB(재조합 발현), ICC에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. Human에 검증됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C11orf1 Antibody
Target: chromosome 11 open reading frame 1 (C11orf1)
Type: Polyclonal Antibody against Human C11orf1
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Recombinant Expression validation)
- ICC (Immunocytochemistry)
Recombinant expression validation: WB에서 타깃 단백질 과발현을 이용한 재조합 발현 검증 수행.
Product Description
Polyclonal antibody raised in rabbit against Human C11orf1.
Validated for multiple applications and purified using the PrEST antigen.
Alternative Gene Names
- FLJ23499
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 11 open reading frame 1 |
| Target Gene | C11orf1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | QERYDLRNIVQPKPLPSQFGHYFETTYDTSYNNKMPLSTHRFKREPHWFPGHQPELDPPRYKCTEKSTYMNSYSKP |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000030962 (87%), Mouse ENSMUSG00000037971 (82%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 대한 최적의 농도 및 조건은 사용자가 결정해야 합니다.
Reference
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C11orf24 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C11orf21 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C11orf1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C10orf99 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C11orf1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.