
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-C11orf1 Antibody
상품 한눈에 보기
Human C11orf1 단백질을 인식하는 Rabbit Polyclonal 항체. IHC, WB(재조합 발현), ICC에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. Human에 검증됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA057519-100 Anti-C11orf1 Antibody, chromosome 11 open reading frame 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057519-25 Anti-C11orf1 Antibody, chromosome 11 open reading frame 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C11orf1 Antibody
Anti-C11orf1 Antibody
Target: chromosome 11 open reading frame 1 (C11orf1)
Type: Polyclonal Antibody against Human C11orf1
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Recombinant Expression validation)
- ICC (Immunocytochemistry)
Recombinant expression validation: WB에서 타깃 단백질 과발현을 이용한 재조합 발현 검증 수행.
Product Description
Polyclonal antibody raised in rabbit against Human C11orf1.
Validated for multiple applications and purified using the PrEST antigen.
Alternative Gene Names
- FLJ23499
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 11 open reading frame 1 |
| Target Gene | C11orf1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | QERYDLRNIVQPKPLPSQFGHYFETTYDTSYNNKMPLSTHRFKREPHWFPGHQPELDPPRYKCTEKSTYMNSYSKP |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000030962 (87%), Mouse ENSMUSG00000037971 (82%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 대한 최적의 농도 및 조건은 사용자가 결정해야 합니다.
Reference
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



