CacheBy
Atlas Antibodies Anti-C11orf1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C11orf1 Antibody

상품 한눈에 보기

Human C11orf1 단백질을 인식하는 Rabbit Polyclonal 항체. IHC, WB(재조합 발현), ICC에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. Human에 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA057519-100 Anti-C11orf1 Antibody, chromosome 11 open reading frame 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057519-25 Anti-C11orf1 Antibody, chromosome 11 open reading frame 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C11orf1 Antibody

Anti-C11orf1 Antibody

Target: chromosome 11 open reading frame 1 (C11orf1)
Type: Polyclonal Antibody against Human C11orf1


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Recombinant Expression validation)
  • ICC (Immunocytochemistry)

Recombinant expression validation: WB에서 타깃 단백질 과발현을 이용한 재조합 발현 검증 수행.


Product Description

Polyclonal antibody raised in rabbit against Human C11orf1.
Validated for multiple applications and purified using the PrEST antigen.


Alternative Gene Names

  • FLJ23499

Target Information

항목 내용
Target Protein chromosome 11 open reading frame 1
Target Gene C11orf1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence QERYDLRNIVQPKPLPSQFGHYFETTYDTSYNNKMPLSTHRFKREPHWFPGHQPELDPPRYKCTEKSTYMNSYSKP
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000030962 (87%), Mouse ENSMUSG00000037971 (82%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 대한 최적의 농도 및 조건은 사용자가 결정해야 합니다.

Reference

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.