CacheBy
Atlas Antibodies Anti-C11orf1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C11orf1 Antibody

상품 한눈에 보기

Human C11orf1 단백질을 인식하는 폴리클로날 토끼 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공합니다. 인간에 대한 반응성이 검증되었습니다.

카탈로그번호
HPA038410-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038410-100 Anti-C11orf1 Antibody, chromosome 11 open reading frame 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038410-25 Anti-C11orf1 Antibody, chromosome 11 open reading frame 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C11orf1 Antibody

Anti-C11orf1 Antibody

Target: chromosome 11 open reading frame 1

  • IHC (Immunohistochemistry)
  • WB (Western Blot) – Recombinant expression validation using target protein overexpression
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human C11orf1

Alternative Gene Names

  • FLJ23499

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein chromosome 11 open reading frame 1
Target Gene C11orf1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000030962 (87%), Mouse ENSMUSG00000037971 (82%)

Antigen Sequence:
QERYDLRNIVQPKPLPSQFGHYFETTYDTSYNNKMPLSTHRFKREPHWFPGHQPELDPPRYKCTEKSTYMNSYSKP

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.