
Atlas Antibodies Anti-BZW2 Antibody
상품 한눈에 보기
인간 BZW2 단백질에 대한 폴리클로날 항체로, WB 및 IHC 응용에 적합. 토끼 유래 IgG 항체이며, 인간·마우스·랫트 반응성 검증 완료. PrEST 항원으로 친화 정제된 고품질 항체.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-BZW2 Antibody
Target Information
- Protein: basic leucine zipper and W2 domains 2
- Gene: BZW2
- Alternative Gene Names: HSPC028, MST017, MSTP017
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human BZW2.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
GLKELSDFLRVQQSLGTRKELQKELQERLSQECPIKEVVLYVKEEMKRNDLPETAVIGLLWTCIMNAVEWNKKEELV
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000020547 | 100% |
| Rat | ENSRNOG00000005096 | 99% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C10orf11 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C10orf107 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BZW2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C10orf10 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BVES Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.