AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-BZW2 Antibody
상품 한눈에 보기
인간 BZW2 단백질에 대한 폴리클로날 항체로, WB 및 IHC 응용에 적합. 토끼 유래 IgG 항체이며, 인간·마우스·랫트 반응성 검증 완료. PrEST 항원으로 친화 정제된 고품질 항체.
- 카탈로그번호
- HPA026709-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA026709-100 Anti-BZW2 Antibody, basic leucine zipper and W2 domains 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026709-25 Anti-BZW2 Antibody, basic leucine zipper and W2 domains 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-BZW2 Antibody
Anti-BZW2 Antibody
Target Information
- Protein: basic leucine zipper and W2 domains 2
- Gene: BZW2
- Alternative Gene Names: HSPC028, MST017, MSTP017
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human BZW2.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
GLKELSDFLRVQQSLGTRKELQKELQERLSQECPIKEVVLYVKEEMKRNDLPETAVIGLLWTCIMNAVEWNKKEELV
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000020547 | 100% |
| Rat | ENSRNOG00000005096 | 99% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.