CacheBy
Atlas Antibodies Anti-C10orf10 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C10orf10 Antibody

상품 한눈에 보기

Human C10orf10 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC에 적합합니다. PrEST 항원을 이용해 Affinity purification 되었으며, Human에 특이적으로 반응합니다. DEPP, FIG, Fseg 유전자명으로도 알려져 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA037819-100 Anti-C10orf10 Antibody, chromosome 10 open reading frame 10 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037819-25 Anti-C10orf10 Antibody, chromosome 10 open reading frame 10 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C10orf10 Antibody

Anti-C10orf10 Antibody

Target: chromosome 10 open reading frame 10 (C10orf10)
Type: Polyclonal Antibody against Human C10orf10


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit, targeting the human C10orf10 protein.
Alternative gene names: DEPP, FIG, Fseg

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 10 open reading frame 10
Target Gene C10orf10
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence PSPSLDDYVRSISRLAQPTSVLDKATAQGQPRPPHRPAQACRKGRPAVSLRDITARFSGQQPTLPMADTVDP
Verified Species Reactivity Human
Interspecies Homology Mouse ENSMUSG00000048489 (57%), Rat ENSRNOG00000023465 (54%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.