
Atlas Antibodies Anti-BTN2A1 Antibody
상품 한눈에 보기
Human BTN2A1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. Human에 대해 검증되었으며, 연구용으로 권장됩니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-BTN2A1 Antibody
Target: butyrophilin, subfamily 2, member A1 (BTN2A1)
Type: Polyclonal Antibody against Human BTN2A1
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against Human BTN2A1, purified by affinity chromatography using the PrEST antigen as affinity ligand.
Alternative Gene Names
BT2.1, BTF1, BTN2.1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | butyrophilin, subfamily 2, member A1 |
| Target Gene | BTN2A1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | ILSGEKEFERETREIALKELEKERVQKEEELQVKEKLQEELRWRRTFLHAVDVVLD |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000053216 (39%), Rat ENSRNOG00000003185 (38%) |
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Storage Notes | Gently mix before use. Determine optimal concentrations and conditions experimentally. |
Material Safety Data Sheet (MSDS)
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-BTN1A1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BTK Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BTN2A1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BTN2A2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BTLA Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.