CacheBy
Atlas Antibodies Anti-BTN2A1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BTN2A1 Antibody

상품 한눈에 보기

Human BTN2A1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. Human에 대해 검증되었으며, 연구용으로 권장됩니다.

카탈로그번호
HPA019208-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA019208-100 Anti-BTN2A1 Antibody, butyrophilin, subfamily 2, member A1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019208-25 Anti-BTN2A1 Antibody, butyrophilin, subfamily 2, member A1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BTN2A1 Antibody

Anti-BTN2A1 Antibody

Target: butyrophilin, subfamily 2, member A1 (BTN2A1)
Type: Polyclonal Antibody against Human BTN2A1


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against Human BTN2A1, purified by affinity chromatography using the PrEST antigen as affinity ligand.


Alternative Gene Names

BT2.1, BTF1, BTN2.1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein butyrophilin, subfamily 2, member A1
Target Gene BTN2A1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence ILSGEKEFERETREIALKELEKERVQKEEELQVKEKLQEELRWRRTFLHAVDVVLD
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000053216 (39%), Rat ENSRNOG00000003185 (38%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Storage Notes Gently mix before use. Determine optimal concentrations and conditions experimentally.

Material Safety Data Sheet (MSDS)


제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.